KCD11_HUMAN Q693B1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q693B1
Recommended name：BTB/POZ domain-containing protein KCTD11
EC number：
Alternative names：(KCASH1 protein) (Potassium channel tetramerization domain-containing protein 11) (RING-type E3 ubiquitin transferase subunit KCTD11)
Cleaved into：
GeneID：147040
Gene names (primary )：KCTD11
Gene names (synonym )：C17orf36 REN
Gene names (ORF )：
Length：232
Mass：25887
Sequence：MLGAMFRAGTPMPPNLNSQGGGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAEADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDSECLGALRARFGVASGDRAEGSPHFHLEWAPRPVELPEVEYGRLGLQPLWTGGPGERREVVGTPSFLEEVLRVALEHGFRLDSVFPDPEDLLNSRSLRFVRH
Tissue specificity：Higher expression in cerebellum than in whole brain and lower expression in medulloblastoma. {ECO:0000269|PubMed:15249678}.
Induction：
Developmental stage：
Protein families：