JKAMP_HUMAN   Q9P055


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9P055

Recommended name:JNK1/MAPK8-associated membrane protein

EC number:

Alternative names:(JKAMP) (JNK1-associated membrane protein) (JAMP) (Medulloblastoma antigen MU-MB-50.4)

Cleaved into:

GeneID:51528

Gene names  (primary ):JKAMP

Gene names  (synonym ):C14orf100 JAMP

Gene names  (ORF ):CDA06 HSPC213 HSPC327

Length:311

Mass:35239

Sequence:MAVDIQPACLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKYCQPCTESPELYDWLYLGFMAMLPLVLHWFFIEWYSGKKSSSALFQHITALFECSMAAIITLLVSDPVGVLYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFIYYAFCLVLMMLLRPLLVKKIACGLGKSDRFKSIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLSLVTLAVYMSASEIENCYDLLVRKKRLIVLFSHWLLHAYGIISISRVDKLEQDLPLLALVPTPALFYLFTAKFTEPSRILSEGANGH

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp