MED29_HUMAN   Q9NX70


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NX70

Recommended name:Mediator of RNA polymerase II transcription subunit 29

EC number:

Alternative names:(Intersex-like protein) (Mediator complex subunit 29)

Cleaved into:

GeneID:55588

Gene names  (primary ):MED29

Gene names  (synonym ):IXL

Gene names  (ORF ):

Length:200

Mass:21073

Sequence:MAASQQQASAASSAAGVSGPSSAGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCANKVTGKTPAPPAGPGGTL

Tissue specificity:Widely expressed in embryo and adult. {ECO:0000269|PubMed:15555573}.

Induction:

Developmental stage:

Protein families:Mediator complex subunit 29 family


   💬 WhatsApp