ADM2_HUMAN   Q7Z4H4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7Z4H4

Recommended name:Protein ADM2

EC number:

Alternative names:(Intermedin)

Cleaved into:Adrenomedullin-2 (AM2) (Intermedin-long) (IMDL); Intermedin-short (IMDS)

GeneID:79924

Gene names  (primary ):ADM2

Gene names  (synonym ):AM2

Gene names  (ORF ):

Length:148

Mass:15865

Sequence:MARIPTAALGCISLLCLQLPGSLSRSLGGDPRPVKPREPPARSPSSSLQPRHPAPRPVVWKLHRALQAQRGAGLAPVMGQPLRDGGRQHSGPRRHSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSYG

Tissue specificity:Expressed in the esophagus, stomach, jejunum, ileum, ileocecum, ascending colon, transverse colon, descending colon and rectum. Expressed in myocardial cells of the heart, renal tubular cells, hypothalamus, and pituitary. {ECO:0000269|PubMed:14615490, ECO:0000269|PubMed:16359754}.

Induction:

Developmental stage:

Protein families:Adrenomedullin family


   💬 WhatsApp