ITBP1_HUMAN   O14713


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O14713

Recommended name:Integrin beta-1-binding protein 1

EC number:

Alternative names:(Integrin cytoplasmic domain-associated protein 1) (ICAP-1)

Cleaved into:

GeneID:9270

Gene names  (primary ):ITGB1BP1

Gene names  (synonym ):ICAP1

Gene names  (ORF ):

Length:200

Mass:21782

Sequence:MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP

Tissue specificity:Expressed in endothelial cells and fibroblasts (at protein level). Ubiquitously expressed. Expressed in intestine, colon, testis, ovary, thymus, spleen and prostate. {ECO:0000269|PubMed:9281591, ECO:0000269|PubMed:9867804}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp