C560_HUMAN Q99643
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99643
Recommended name：Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
EC number：
Alternative names：(Integral membrane protein CII-3) (QPs-1) (QPs1) (Succinate dehydrogenase complex subunit C) (Succinate-ubiquinone oxidoreductase cytochrome B large subunit) (CYBL)
Cleaved into：
GeneID：6391
Gene names (primary )：SDHC
Gene names (synonym )：CYB560 SDH3
Gene names (ORF )：
Length：169
Mass：18610
Sequence：MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYLELVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLKIPQLYQSGVVVLVLTVLSSMGLAAM
Tissue specificity：
Induction：
Developmental stage：
Protein families：Cytochrome b560 family