INSL5_HUMAN   Q9Y5Q6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y5Q6

Recommended name:Insulin-like peptide INSL5

EC number:

Alternative names:(Insulin-like peptide 5)

Cleaved into:Insulin-like peptide INSL5 B chain; Insulin-like peptide INSL5 A chain

GeneID:10022

Gene names  (primary ):INSL5

Gene names  (synonym ):

Gene names  (ORF ):UNQ156/PRO182

Length:135

Mass:15333

Sequence:MKGSIFTLFLFSVLFAISEVRSKESVRLCGLEYIRTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTLCCTDGCSMTDLSALC

Tissue specificity:Highly expressed in rectum with lower levels in uterus and ascending and descending colon. {ECO:0000269|PubMed:10458910}.

Induction:

Developmental stage:

Protein families:Insulin family


   💬 WhatsApp