TI17A_HUMAN   Q99595


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99595

Recommended name:Mitochondrial import inner membrane translocase subunit Tim17-A

EC number:

Alternative names:(Inner membrane preprotein translocase Tim17a)

Cleaved into:

GeneID:10440

Gene names  (primary ):TIMM17A

Gene names  (synonym ):MIMT17 TIM17 TIM17A TIMM17

Gene names  (ORF ):

Length:171

Mass:18024

Sequence:MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ

Tissue specificity:

Induction:

Developmental stage:

Protein families:Tim17/Tim22/Tim23 family


   💬 WhatsApp