BIRC8_HUMAN   Q96P09


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96P09

Recommended name:Baculoviral IAP repeat-containing protein 8

EC number:

Alternative names:(Inhibitor of apoptosis-like protein 2) (IAP-like protein 2) (ILP-2) (Testis-specific inhibitor of apoptosis)

Cleaved into:

GeneID:

Gene names  (primary ):BIRC8

Gene names  (synonym ):ILP2

Gene names  (ORF ):

Length:236

Mass:27089

Sequence:MTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTTKKTPSLTKRISDTIFPNPMLQEAIRMGFDFKDVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENELNQTSLQREISPEEPLRRLQEEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRCPMCSAVIDFKQRVFMS

Tissue specificity:Testis specific in normal tissues.

Induction:

Developmental stage:

Protein families:IAP family


   💬 WhatsApp