UBP50_HUMAN   Q70EL3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q70EL3

Recommended name:Inactive ubiquitin carboxyl-terminal hydrolase 50

EC number:

Alternative names:(Inactive ubiquitin-specific peptidase 50)

Cleaved into:

GeneID:373509

Gene names  (primary ):USP50

Gene names  (synonym ):

Gene names  (ORF ):

Length:339

Mass:38955

Sequence:MTSQPSLPADDFDIYHVLAECTDYYDTLPVKEADGNQPHFQGVTGLWNLGNTCCVNAISQCLCSILPLVEYFLTGKYITALQKFLLPSDCSEVATAFAYLMTDMWLGDSDCVSPEIFWSALGNLYPAFTKKMQQDAQEFLICVLNELHEALKKYHYSRRRSYEKGSTQRCCRKWITTETSIITQLFEEQLNYSIVCLKCEKCTYKNEVFTVFSLPIPSKYECSLRDCLQCFFQQDALTWNNEIHCSFCETKQETAVRASISKAPKIIIFHLKRFDIQGTTKRKLRTDIHYPLTNLDLTPYICSIFRKYPKYNLCAVVNHFGDLDGGHYTAFCKNSVTQA

Tissue specificity:Weakly expressed in a few tissues. {ECO:0000269|PubMed:14715245}.

Induction:

Developmental stage:

Protein families:Peptidase C19 family


   💬 WhatsApp