MSMB_HUMAN P08118
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P08118
Recommended name：Beta-microseminoprotein
EC number：
Alternative names：(Immunoglobulin-binding factor) (IGBF) (PN44) (Prostate secreted seminal plasma protein) (Prostate secretory protein of 94 amino acids) (PSP-94) (PSP94) (Seminal plasma beta-inhibin)
Cleaved into：
GeneID：4477
Gene names (primary )：MSMB
Gene names (synonym )：PRSP
Gene names (ORF )：
Length：114
Mass：12865
Sequence：MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
Tissue specificity：Strongly expressed in prostate, liver, kidney, breast and penis. Also expressed in pancreas, esophagus, stomach, deodenum, colon, trachea, lung, salivary glands and fallopian tube. PSP94 is expressed in lung and breast, whereas PSP57 is found in kidney and bladder. {ECO:0000269|PubMed:7566962, ECO:0000269|PubMed:7671139}.
Induction：
Developmental stage：
Protein families：Beta-microseminoprotein family