IL25_HUMAN   Q9H293


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H293

Recommended name:Interleukin-25

EC number:

Alternative names:(IL-25) (Interleukin-17E) (IL-17E)

Cleaved into:

GeneID:64806

Gene names  (primary ):IL25

Gene names  (synonym ):IL17E

Gene names  (ORF ):UNQ3120/PRO10272

Length:177

Mass:20330

Sequence:MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG

Tissue specificity:Expressed at low levels in several tissues, including brain, kidney, lung, prostate, testis, spinal cord, adrenal gland, and trachea.

Induction:

Developmental stage:

Protein families:IL-17 family


   💬 WhatsApp