IL1RA_HUMAN   P18510


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P18510

Recommended name:Interleukin-1 receptor antagonist protein

EC number:

Alternative names:(IL-1RN) (IL-1ra) (IRAP) (ICIL-1RA) (IL1 inhibitor) (Anakinra)

Cleaved into:

GeneID:3557

Gene names  (primary ):IL1RN

Gene names  (synonym ):IL1F3 IL1RA

Gene names  (ORF ):

Length:177

Mass:20055

Sequence:MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Tissue specificity:The intracellular form of IL1RN is predominantly expressed in epithelial cells.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp