I18BP_HUMAN   O95998


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O95998

Recommended name:Interleukin-18-binding protein

EC number:

Alternative names:(IL-18BP) (Tadekinig-alfa)

Cleaved into:

GeneID:10068

Gene names  (primary ):IL18BP

Gene names  (synonym ):

Gene names  (ORF ):

Length:194

Mass:21099

Sequence:MTMRHNWTPDLSPLWVLLLCAHVVTLLVRATPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG

Tissue specificity:Strongly expressed in heart, lung, placenta and spleen. {ECO:0000269|PubMed:10023777, ECO:0000269|PubMed:10094485}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp