I18BP_HUMAN O95998
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O95998
Recommended name：Interleukin-18-binding protein
EC number：
Alternative names：(IL-18BP) (Tadekinig-alfa)
Cleaved into：
GeneID：10068
Gene names (primary )：IL18BP
Gene names (synonym )：
Gene names (ORF )：
Length：194
Mass：21099
Sequence：MTMRHNWTPDLSPLWVLLLCAHVVTLLVRATPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
Tissue specificity：Strongly expressed in heart, lung, placenta and spleen. {ECO:0000269|PubMed:10023777, ECO:0000269|PubMed:10094485}.
Induction：
Developmental stage：
Protein families：