IL17B_HUMAN   Q9UHF5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UHF5

Recommended name:Interleukin-17B

EC number:

Alternative names:(IL-17B) (Cytokine Zcyto7) (Interleukin-20) (IL-20) (Neuronal interleukin-17-related factor)

Cleaved into:

GeneID:27190

Gene names  (primary ):IL17B

Gene names  (synonym ):IL20 NIRF ZCYTO7

Gene names  (ORF ):UNQ516/PRO1031

Length:180

Mass:20437

Sequence:MDWPHNLLFLLTISIFLGLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF

Tissue specificity:Expressed in adult pancreas, small intestine, stomach, spinal cord and testis. Less pronounced expression in prostate, colon mucosal lining, and ovary.

Induction:

Developmental stage:

Protein families:IL-17 family


   💬 WhatsApp