IL10_HUMAN P22301
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P22301
Recommended name：Interleukin-10
EC number：
Alternative names：(IL-10) (Cytokine synthesis inhibitory factor) (CSIF)
Cleaved into：
GeneID：3586
Gene names (primary )：IL10
Gene names (synonym )：
Gene names (ORF )：
Length：178
Mass：20517
Sequence：MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Tissue specificity：Produced by a variety of cell lines, including T-cells, macrophages, mast cells and other cell types. {ECO:0000269|PubMed:1940799, ECO:0000269|PubMed:7512027}.
Induction：
Developmental stage：
Protein families：IL-10 family