GBG4_HUMAN   P50150


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P50150

Recommended name:Guanine nucleotide-binding protein G

EC number:

Alternative names:(I)/G(S)/G(O) subunit gamma-4

Cleaved into:

GeneID:2786

Gene names  (primary ):GNG4

Gene names  (synonym ):GNGT4

Gene names  (ORF ):

Length:75

Mass:8389

Sequence:MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKFFCTIL

Tissue specificity:Brain, kidney, pancreas, skeletal muscle and faintly in cardiac muscle.

Induction:

Developmental stage:

Protein families:G protein gamma family


   💬 WhatsApp