GBG10_HUMAN P50151
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P50151
Recommended name：Guanine nucleotide-binding protein G
EC number：
Alternative names：(I)/G(S)/G(O) subunit gamma-10
Cleaved into：
GeneID：2790
Gene names (primary )：GNG10
Gene names (synonym )：GNGT10
Gene names (ORF )：
Length：68
Mass：7205
Sequence：MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL
Tissue specificity：Abundantly and ubiquitously expressed.
Induction：
Developmental stage：
Protein families：G protein gamma family