OSTC_HUMAN   Q9NRP0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NRP0

Recommended name:Oligosaccharyltransferase complex subunit OSTC

EC number:

Alternative names:(Hydrophobic protein HSF-28)

Cleaved into:

GeneID:58505

Gene names  (primary ):OSTC

Gene names  (synonym ):

Gene names  (ORF ):DC2 HDCMD45P HSPC307

Length:149

Mass:16829

Sequence:METLYRVPFLVLECPNLKLKKPPWLHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG

Tissue specificity:

Induction:

Developmental stage:

Protein families:OSTC family


   💬 WhatsApp