VP37B_HUMAN   Q9H9H4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H9H4

Recommended name:Vacuolar protein sorting-associated protein 37B

EC number:

Alternative names:(hVps37B) (ESCRT-I complex subunit VPS37B)

Cleaved into:

GeneID:79720

Gene names  (primary ):VPS37B

Gene names  (synonym ):

Gene names  (ORF ):

Length:285

Mass:31307

Sequence:MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNLLYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQALAPLPPRLPELAPTAPLPYPAPEASGPPAVAPRRIPPPPPPVPAGRLATPFTAAMSSGQAVPYPGLQCPPLPPRVGLPTQQGFSSQFVSPYPPPLPQRPPPRLPPHQPGFILQ

Tissue specificity:Widely expressed. Expressed in macrophages and lymphocytes. {ECO:0000269|PubMed:15218037}.

Induction:

Developmental stage:

Protein families:VPS37 family


   💬 WhatsApp