DRB_HUMAN P01911
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P01911
Recommended name：HLA class II histocompatibility antigen, DRB1 beta chain
EC number：
Alternative names：(Human leukocyte antigen DRB1) (HLA-DRB1)
Cleaved into：
GeneID：3123
Gene names (primary )：HLA-DRB1
Gene names (synonym )：
Gene names (ORF )：
Length：266
Mass：29966
Sequence：MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
Tissue specificity：Expressed in professional APCs: macrophages, dendritic cells and B cells. {ECO:0000269|PubMed:31495665}.
Induction：
Developmental stage：
Protein families：