EP3A_HUMAN Q14507
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q14507
Recommended name：Epididymal secretory protein E3-alpha
EC number：
Alternative names：(Human epididymis-specific protein 3-alpha) (HE3-alpha)
Cleaved into：
GeneID：10876
Gene names (primary )：EDDM3A
Gene names (synonym )：FAM12A HE3A
Gene names (ORF )：
Length：147
Mass：17646
Sequence：MTSSLKIWGILLALLCILCRLCVYSNNIYWREFIKLHYLSPSREFKEYKCDVLMREKEALKGKSFHMFIYSLWFKIQRACINEKGSDRYRNAYVWAPGALKVLECHWEKYNNRYTESRSFSYIEFHCGVDGYVDNIEDLRIIEPISN
Tissue specificity：Epididymis, with predominant expression in the corpus region. Moderately expressed in the vas deferens; only low levels are detectable in the caput and cauda regions.
Induction：
Developmental stage：
Protein families：