ST20_HUMAN   Q9HBF5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9HBF5

Recommended name:Suppressor of tumorigenicity 20 protein

EC number:

Alternative names:(Human cervical cancer suppressor gene 1 protein) (HCCS-1)

Cleaved into:

GeneID:

Gene names  (primary ):ST20

Gene names  (synonym ):HCCS1

Gene names  (ORF ):

Length:79

Mass:9024

Sequence:MARSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLFCPEAILLTRKDTPYCETGLIFLTLTKTIANTYFYF

Tissue specificity:Expressed in leukocytes, lung, spleen, liver, heart, kidney, muscle and uterine cervix. Down-regulated in cervical cancer. {ECO:0000269|PubMed:11857354}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp