PDCL3_HUMAN Q9H2J4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9H2J4
Recommended name：Phosducin-like protein 3
EC number：
Alternative names：(HTPHLP) (PhPL3) (Viral IAP-associated factor 1) (VIAF-1)
Cleaved into：
GeneID：79031
Gene names (primary )：PDCL3
Gene names (synonym )：PhLP2A VIAF1
Gene names (ORF )：
Length：239
Mass：27614
Sequence：MQDPNADTEWNDILRKKGILPPKESLKELEEEAEEEQRILQQSVVKTYEDMTLEELEDHEDEFNEEDERAIEMYRRRRLAEWKATKLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCALINQHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTIFVYLEGDIKAQFIGPLVFGGMNLTRDELEWKLSESGAIMTDLEENPKKPIEDVLLSSVRRSVLMKRDSDSEGD
Tissue specificity：Expressed in endothelial cells (at protein level) (PubMed:26059764). Expressed in all tissues examined including spleen, thymus, prostate, testis, ovary, small intestine and colon (PubMed:15371430). {ECO:0000269|PubMed:15371430, ECO:0000269|PubMed:26059764}.
Induction：
Developmental stage：
Protein families：Phosducin family