SWET1_HUMAN Q9BRV3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BRV3
Recommended name：Sugar transporter SWEET1
EC number：
Alternative names：(HsSWEET1) (RAG1-activating protein 1) (Solute carrier family 50 member 1) (Stromal cell protein)
Cleaved into：
GeneID：55974
Gene names (primary )：SLC50A1
Gene names (synonym )：RAG1AP1 SCP
Gene names (ORF )：
Length：221
Mass：25030
Sequence：MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDGILIVVNTVGAALQTLYILAYLHYCPRKRVVLLQTATLLGVLLLGYGYFWLLVPNPEARLQQLGLFCSVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFPGIVTSFIRFWLFWKYPQEQDRNYWLLQT
Tissue specificity：Ubiquitously expressed with highest expression in oviduct, epididymis and intestine. {ECO:0000269|PubMed:21107422}.
Induction：
Developmental stage：
Protein families：SWEET sugar transporter family