HSPB2_HUMAN Q16082
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q16082
Recommended name:Heat shock protein beta-2
EC number:
Alternative names:(HspB2) (DMPK-binding protein) (MKBP)
Cleaved into:
GeneID:3316
Gene names (primary ):HSPB2
Gene names (synonym ):
Gene names (ORF ):
Length:182
Mass:20233
Sequence:MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP
Tissue specificity:Expressed preferentially in skeletal muscle and heart but not in the lens.
Induction:
Developmental stage:
Protein families:Small heat shock protein (HSP20) family