NAA80_HUMAN Q93015
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q93015
Recommended name：N-alpha-acetyltransferase 80
EC number：EC:2.3.1.-
Alternative names：(HsNAAA80) (N-acetyltransferase 6) (Protein fusion-2) (Protein fus-2)
Cleaved into：
GeneID：24142
Gene names (primary )：NAA80
Gene names (synonym )：FUS2 NAT6
Gene names (ORF )：
Length：286
Mass：31445
Sequence：MELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTELTLDPEHQPEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGPKGPPLPPPPPLPECLTISPPVPSGPPSKSLLETQYQNVRGRPIFWMEKDI
Tissue specificity：Strongly expressed in heart and skeletal muscle, followed by brain and pancreas, with weak expression in kidney, liver, and lung and no expression in placenta. {ECO:0000269|PubMed:11085536}.
Induction：
Developmental stage：
Protein families：Acetyltransferase family