HMSDV_HUMAN   P0C7T4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0C7T4

Recommended name:Minor histocompatibility protein HMSD variant form

EC number:

Alternative names:(HSMD-v)

Cleaved into:Minor histocompatibility antigen ACC-6 (mHA ACC-6)

GeneID:

Gene names  (primary ):HMSD

Gene names  (synonym ):C18orf53

Gene names  (ORF ):

Length:53

Mass:6023

Sequence:MEIFIEVFSHFLLQLTELTLNMCLELPTGSLEKSLMISSQVLQIPVANSTKQR

Tissue specificity:Highly expressed in dendritic cells and primary leukemia cells, especially those of myeloid lineage. ACC-6 expression is limited to cells of the hematopoietic lineage. {ECO:0000269|PubMed:17409267}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp