O10A5_HUMAN Q9H207
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9H207
Recommended name：Olfactory receptor 10A5
EC number：
Alternative names：(HP3) (Olfactory receptor 10A1) (Olfactory receptor 11-403) (OR11-403) (Olfactory receptor-like protein JCG6)
Cleaved into：
GeneID：144124
Gene names (primary )：OR10A5
Gene names (synonym )：OR10A1
Gene names (ORF )：
Length：317
Mass：35519
Sequence：MAIGNWTEISEFILMSFSSLPTEIQSLLFLTFLTIYLVTLKGNSLIILVTLADPMLHSPMYFFLRNLSFLEIGFNLVIVPKMLGTLLAQDTTISFLGCATQMYFFFFFGVAECFLLATMAYDRYVAICSPLHYPVIMNQRTRAKLAAASWFPGFPVATVQTTWLFSFPFCGTNKVNHFFCDSPPVLKLVCADTALFEIYAIVGTILVVMIPCLLILCSYTRIAAAILKIPSAKGKHKAFSTCSSHLLVVSLFYISSSLTYFWPKSNNSPESKKLLSLSYTVVTPMLNPIIYSLRNSEVKNALSRTFHKVLALRNCIP
Tissue specificity：Expressed in the tongue.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family