SIX6_HUMAN   O95475


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O95475

Recommended name:Homeobox protein SIX6

EC number:

Alternative names:(Homeodomain protein OPTX2) (Optic homeobox 2) (Sine oculis homeobox homolog 6)

Cleaved into:

GeneID:4990

Gene names  (primary ):SIX6

Gene names  (synonym ):OPTX2 SIX9

Gene names  (ORF ):

Length:246

Mass:27687

Sequence:MFQLPILNFSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLSQGSGRALRAEGDGTPEVLGVATSPAASLSSKAATSAISITSSDSECDI

Tissue specificity:Expressed in the developing and adult retina. Also expressed in the hypothalamic and the pituitary regions.

Induction:

Developmental stage:

Protein families:SIX/Sine oculis homeobox family


   💬 WhatsApp