HXC5_HUMAN   Q00444


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q00444

Recommended name:Homeobox protein Hox-C5

EC number:

Alternative names:(Homeobox protein CP11) (Homeobox protein Hox-3D)

Cleaved into:

GeneID:3222

Gene names  (primary ):HOXC5

Gene names  (synonym ):HOX3D

Gene names  (ORF ):

Length:222

Mass:24976

Sequence:MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPRAHPDRPACSAAAAPGHAPGRDEAAPLNPGMYSQKAARPALEERAKSSGEIKEEQAQTGQPAGLSQPPAPPQIYPWMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKSKEAL

Tissue specificity:

Induction:

Developmental stage:

Protein families:Antp homeobox family


   💬 WhatsApp