RT63_HUMAN Q9BQC6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BQC6
Recommended name：Ribosomal protein 63, mitochondrial
EC number：
Alternative names：(hMRP63) (Mitochondrial large ribosomal subunit protein mL63) (Mitochondrial ribosomal protein 63) (Mitochondrial ribosomal protein L57)
Cleaved into：
GeneID：78988
Gene names (primary )：MRPL57
Gene names (synonym )：MRP63
Gene names (ORF )：
Length：102
Mass：12266
Sequence：MFLTALLWRGRIPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQERGHAAVRRREAFEAIKAAATSKFPPHRFIADQLDHLNVTKKWS
Tissue specificity：
Induction：
Developmental stage：
Protein families：Mitochondrion-specific ribosomal protein mL63 family