MED7_HUMAN O43513
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O43513
Recommended name：Mediator of RNA polymerase II transcription subunit 7
EC number：
Alternative names：(hMED7) (Activator-recruited cofactor 34 kDa component) (ARC34) (Cofactor required for Sp1 transcriptional activation subunit 9) (CRSP complex subunit 9) (Mediator complex subunit 7) (RNA polymerase transcriptional regulation mediator subunit 7 homolog) (Transcriptional coactivator CRSP33)
Cleaved into：
GeneID：9443
Gene names (primary )：MED7
Gene names (synonym )：ARC34 CRSP9
Gene names (ORF )：
Length：233
Mass：27245
Sequence：MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP
Tissue specificity：
Induction：
Developmental stage：
Protein families：Mediator complex subunit 7 family