HCP5_HUMAN Q6MZN7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6MZN7
Recommended name：HLA class I histocompatibility antigen protein P5
EC number：
Alternative names：(HLA complex protein P5) (Protein P5-1)
Cleaved into：
GeneID：
Gene names (primary )：HCP5
Gene names (synonym )：
Gene names (ORF )：
Length：132
Mass：14098
Sequence：MLLRMSEHRNEALGNYLEMRLKSSFLRGLGSWKSNPLRLGGWTILLTLTMGQGEPGGPQGDPWVPHELLLPSLCDSSHASSWGSGSITCAWRGGDSSSHPLVSGHILSNSPVAAVMCSSMGTHLSPFKGTLL
Tissue specificity：Expressed in lymphoid tissues; Detected in spleen as well as in B-cell lines, NK cell lines and activated lymphocytes. {ECO:0000269|PubMed:8462994}.
Induction：
Developmental stage：
Protein families：