PBMU2_HUMAN   E2RYF7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:E2RYF7

Recommended name:Protein PBMUCL2

EC number:

Alternative names:(HLA complex group 22) (Panbronchiolitis-related mucin-like protein 2)

Cleaved into:

GeneID:285834

Gene names  (primary ):HCG22

Gene names  (synonym ):G2 PBMUCL2

Gene names  (ORF ):

Length:251

Mass:26282

Sequence:MPRYVPLLLLLLLLRCSERGGGVNFGEKDAKVPGTWRDGVRVPGEGASWDSDRASPERRYGIVGLSQSISTKHPETSPKDSRIRENDVTADGRTTEDHITADPGTTEDSVTADPGTTEDNVTVDPGTTEGSVTADPATTKDYVSADPGTTKDSVTADPGTTENFVTADPGTTKDSITADPRTTEDSVTADPGTTKHSITVDPGTTEDSVTADPGTTKHSITADPGTTEDSVTADPGTTEDETTKHGDTHLL

Tissue specificity:Detected in the brain, lung, spleen, thymus and prostate. {ECO:0000269|PubMed:20981447}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp