H3Y1_HUMAN   P0DPK2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0DPK2

Recommended name:Histone H3.Y

EC number:

Alternative names:(Histone H3.Y1)

Cleaved into:

GeneID:

Gene names  (primary ):H3Y1

Gene names  (synonym ):

Gene names  (ORF ):

Length:136

Mass:15423

Sequence:MARTKQTARKATAWQAPRKPLATKAAGKRAPPTGGIKKPHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTIMPRDMQLARRLRREGP

Tissue specificity:Expressed at low level in some tissues, such as testis and brain. {ECO:0000269|PubMed:20819935}.

Induction:

Developmental stage:

Protein families:Histone H3 family


   💬 WhatsApp