H3C_HUMAN   Q6NXT2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6NXT2

Recommended name:Histone H3.3C

EC number:

Alternative names:(Histone H3.5)

Cleaved into:

GeneID:440093

Gene names  (primary ):H3-5

Gene names  (synonym ):H3F3C

Gene names  (ORF ):

Length:135

Mass:15214

Sequence:MARTKQTARKSTGGKAPRKQLATKAARKSTPSTCGVKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFNTDLRFQSAAVGALQEASEAYLVGLLEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Tissue specificity:Specifically expressed in the seminiferous tubules of testis. {ECO:0000269|PubMed:21274551}.

Induction:

Developmental stage:

Protein families:Histone H3 family


   💬 WhatsApp