H2B1L_HUMAN Q99880
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99880
Recommended name：Histone H2B type 1-L
EC number：
Alternative names：(Histone H2B.c) (H2B/c)
Cleaved into：
GeneID：8340
Gene names (primary )：H2BC13
Gene names (synonym )：H2BFC HIST1H2BL
Gene names (ORF )：
Length：126
Mass：13952
Sequence：MPELAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Tissue specificity：
Induction：
Developmental stage：
Protein families：Histone H2B family