H2B1A_HUMAN   Q96A08


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96A08

Recommended name:Histone H2B type 1-A

EC number:

Alternative names:(Histone H2B, testis) (TSH2B.1) (hTSH2B) (Testis-specific histone H2B)

Cleaved into:

GeneID:255626

Gene names  (primary ):H2BC1

Gene names  (synonym ):HIST1H2BA TSH2B

Gene names  (ORF ):

Length:127

Mass:14167

Sequence:MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Tissue specificity:Mainly expressed in testis, and the corresponding protein is also present in mature sperm (at protein level). Also found in some fat cells. {ECO:0000269|PubMed:12213818, ECO:0000269|PubMed:21249133}.

Induction:

Developmental stage:

Protein families:Histone H2B family


   💬 WhatsApp