H2A1J_HUMAN Q99878
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99878
Recommended name：Histone H2A type 1-J
EC number：
Alternative names：(Histone H2A/e)
Cleaved into：
GeneID：8331
Gene names (primary )：H2AC14
Gene names (synonym )：H2AFE HIST1H2AJ
Gene names (ORF )：
Length：128
Mass：13936
Sequence：MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKTK
Tissue specificity：
Induction：
Developmental stage：
Protein families：Histone H2A family