H15_HUMAN   P16401


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P16401

Recommended name:Histone H1.5

EC number:

Alternative names:(Histone H1a) (Histone H1b) (Histone H1s-3)

Cleaved into:

GeneID:3009

Gene names  (primary ):H1-5

Gene names  (synonym ):H1F5 HIST1H1B

Gene names  (ORF ):

Length:226

Mass:22580

Sequence:MSETAPAETATPAPVEKSPAKKKATKKAAGAGAAKRKATGPPVSELITKAVAASKERNGLSLAALKKALAAGGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKKAGAAKAKKPAGATPKKAKKAAGAKKAVKKTPKKAKKPAAAGVKKVAKSPKKAKAAAKPKKATKSPAKPKAVKPKAAKPKAAKPKAAKPKAAKAKKAAAKKK

Tissue specificity:Ubiquitous. Expressed in the majority of the cell lines tested and in testis. {ECO:0000269|PubMed:9031620}.

Induction:

Developmental stage:

Protein families:Histone H1/H5 family


   💬 WhatsApp