HIS1_HUMAN   P15515


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P15515

Recommended name:Histatin-1

EC number:

Alternative names:(Histidine-rich protein 1) (Post-PB protein) (PPB)

Cleaved into:His1-(31-57)-peptide (His1 31/57) (His1-(12-38)-peptide) (His1 12/38) (Histatin-2)

GeneID:3346

Gene names  (primary ):HTN1

Gene names  (synonym ):HIS1

Gene names  (ORF ):

Length:57

Mass:6963

Sequence:MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN

Tissue specificity:Submandibular and parotid glands. {ECO:0000269|PubMed:17503797}.

Induction:

Developmental stage:

Protein families:Histatin/statherin family


   💬 WhatsApp