HINT2_HUMAN Q9BX68
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BX68
Recommended name：Histidine triad nucleotide-binding protein 2, mitochondrial
EC number：EC:3.-.-.-
Alternative names：(HINT-2) (HINT-3) (HIT-17kDa) (PKCI-1-related HIT protein)
Cleaved into：
GeneID：84681
Gene names (primary )：HINT2
Gene names (synonym )：
Gene names (ORF )：
Length：163
Mass：17162
Sequence：MAAAVVLAAGLRAARRAVAATGVRGGQVRGAAGVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG
Tissue specificity：High expression in liver and pancreas. Expression is significantly down-regulated in hepatocellular carcinoma (HCC) patients. {ECO:0000269|PubMed:16762638}.
Induction：
Developmental stage：
Protein families：HINT family