KR111_HUMAN   Q8IUC1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8IUC1

Recommended name:Keratin-associated protein 11-1

EC number:

Alternative names:(High sulfur keratin-associated protein 11.1)

Cleaved into:

GeneID:337880

Gene names  (primary ):KRTAP11-1

Gene names  (synonym ):KAP11.1 KRTAP11.1

Gene names  (ORF ):

Length:163

Mass:17085

Sequence:MSFNCSTRNCSSRPIGGRCIVPVAQVTTTSTTDADCLGGICLPSSFQTGSWLLDHCQETCCEPTACQPTCYRRTSCVSNPCQVTCSRQTTCISNPCSTTYSRPLTFVSSGCQPLGGISSVCQPVGGISTVCQPVGGVSTVCQPACGVSRTYQQSCVSSCRRTC

Tissue specificity:Expressed in the upper matrix and in the entire hair cortex.

Induction:

Developmental stage:

Protein families:PMG family


   💬 WhatsApp