KR101_HUMAN P60331
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P60331
Recommended name:Keratin-associated protein 10-1
EC number:
Alternative names:(High sulfur keratin-associated protein 10.1) (Keratin-associated protein 10.1) (Keratin-associated protein 18-1) (Keratin-associated protein 18.1)
Cleaved into:
GeneID:386677
Gene names (primary ):KRTAP10-1
Gene names (synonym ):KAP10.1 KAP18-1 KRTAP10.1 KRTAP18-1 KRTAP18.1
Gene names (ORF ):
Length:282
Mass:28660
Sequence:MAASTMSVCSSACSDSWQVDACPESCCEPHCCALSCCAPAPCLTLVCTPVSRVSSPCCQAACEPSPCQSGCTSSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCLPTCSKDSSSCCQQSSCQPTCCASSSSQQSCCVPVCCKPVCYVPTCSEDSSSCCQQSSCHPACCTSSPCQQACCVPVRCKPVCCKPICCVPVCSGASTSCCQQSSCQPACCTTSCCRPSSSVSLLCRPVCRPACCMPVSSCCAPASSCQASCCRPASCVSLLCRPACSRPAC
Tissue specificity:Restricted to a narrow region of the hair fiber cuticle, lying approximately 20 cell layers above the apex of the dermal papilla of the hair root; not detected in any other tissues. {ECO:0000269|PubMed:14962103, ECO:0000269|PubMed:15028290}.
Induction:
Developmental stage:
Protein families:KRTAP type 10 family