KRA81_HUMAN   Q8IUC2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8IUC2

Recommended name:Keratin-associated protein 8-1

EC number:

Alternative names:(High glycine-tyrosine keratin-associated protein 8.1)

Cleaved into:

GeneID:337879

Gene names  (primary ):KRTAP8-1

Gene names  (synonym ):KAP8.1 KRTAP8.1

Gene names  (ORF ):

Length:63

Mass:6826

Sequence:MLCDNFPGAVFPGCYWGSYGYPLGYSVGCGYGSTYSPVGYGFGYGYNGCGAFGYRRYSPFALY

Tissue specificity:Is essentially restricted to only one vertical half of the hair forming compartment and in beard hairs is absent from the central medulla.

Induction:

Developmental stage:

Protein families:KRTAP type 8 family


   💬 WhatsApp