HIG2B_HUMAN   Q4VC39


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q4VC39

Recommended name:Putative HIG1 domain family member 2B

EC number:

Alternative names:(HIG1 domain family member 2B pseudogene)

Cleaved into:

GeneID:

Gene names  (primary ):HIGD2B

Gene names  (synonym ):HIGD2BP

Gene names  (ORF ):

Length:106

Mass:11405

Sequence:MATLGFVTPEAPFESSKPPIFEGLSPTVYSNPEGFKEKFLRKTRENPVVPIGFLCTAAVLTNGLYCFHQGNSQCSRLMMHTQIAAQGFTIAAILLGLAATAMKSPP

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp