RE113_HUMAN P61574
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61574
Recommended name：Endogenous retrovirus group K member 113 Rec protein
EC number：
Alternative names：(HERV-K113 Rec protein) (HERV-K_19p13.11 provirus Rec protein)
Cleaved into：
GeneID：
Gene names (primary )：HERVK_113
Gene names (synonym )：
Gene names (ORF )：
Length：105
Mass：11920
Sequence：MNPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVTQTPESMLLAALMIVSMVSYGVPNSSEETATIENGP
Tissue specificity：
Induction：
Developmental stage：
Protein families：