HBAT_HUMAN   P09105


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P09105

Recommended name:Hemoglobin subunit theta-1

EC number:

Alternative names:(Hemoglobin theta-1 chain) (Theta-1-globin)

Cleaved into:

GeneID:3049

Gene names  (primary ):HBQ1

Gene names  (synonym ):

Gene names  (ORF ):

Length:142

Mass:15508

Sequence:MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSEYR

Tissue specificity:

Induction:

Developmental stage:

Protein families:Globin family


   💬 WhatsApp