TPD55_HUMAN   Q96J77


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96J77

Recommended name:Tumor protein D55

EC number:

Alternative names:(hD55) (Testis development protein NYD-SP25) (Tumor protein D52-like 3)

Cleaved into:

GeneID:89882

Gene names  (primary ):TPD52L3

Gene names  (synonym ):

Gene names  (ORF ):

Length:140

Mass:15503

Sequence:MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALVGLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATFRSFEGLMGTIKSKVSGGKRAWP

Tissue specificity:Specifically expressed in testis. Expressed at 5.6-fold higher levels in adult testis than in fetal testis. {ECO:0000269|PubMed:16631610}.

Induction:

Developmental stage:

Protein families:TPD52 family


   💬 WhatsApp